PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna27137.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family STAT
Protein Properties Length: 1080aa    MW: 120748 Da    PI: 7.5851
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna27137.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT1712.1e-532773941118
                     STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrik 86 
                              ldvvll+a++++++k++ev+asL y d+g++v+k++d e+pLL+  dG+ef+s drp+k+++GrasfklkisqLsskcdnrLfri 
  mrna27137.1-v1.0-hybrid 277 LDVVLLDAFSHTINKELEVIASLAYYDNGAHVDKTSDGEPPLLAIHDGIEFASCDRPTKVVQGRASFKLKISQLSSKCDNRLFRII 362
                              8************************************************************************************* PP

                     STAT  87 feipklkkypfleavskpirCisrsrntrsss 118
                              f+ip+ ++ypfl+a++ pirC+s s+n+  ss
  mrna27137.1-v1.0-hybrid 363 FQIPNWENYPFLKAFTPPIRCVSPSHNAVVSS 394
                              *************************9987665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF498992.88E-1066225IPR013320Concanavalin A-like lectin/glucanase domain
Gene3DG3DSA:2.60.120.2003.4E-778220IPR013320Concanavalin A-like lectin/glucanase domain
Gene3DG3DSA:3.30.505.105.9E-7633705IPR000980SH2 domain
SuperFamilySSF555501.21E-7635731IPR000980SH2 domain
PROSITE profilePS500019.485641734IPR000980SH2 domain
Gene3DG3DSA:3.30.200.201.8E-18787875No hitNo description
SuperFamilySSF561129.85E-767921072IPR011009Protein kinase-like domain
PROSITE profilePS5001140.1748001079IPR000719Protein kinase domain
SMARTSM002204.7E-348001079IPR000719Protein kinase domain
PfamPF000691.2E-478021068IPR000719Protein kinase domain
PROSITE patternPS001070806828IPR017441Protein kinase, ATP binding site
Gene3DG3DSA:1.10.510.101.2E-458781071No hitNo description
PROSITE patternPS001080922934IPR008271Serine/threonine-protein kinase, active site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006468Biological Processprotein phosphorylation
GO:0004672Molecular Functionprotein kinase activity
GO:0005524Molecular FunctionATP binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009001anatomyfruit
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007027developmental stagewhole plant fruit formation stage 70% to final size
Sequence ? help Back to Top
Protein Sequence    Length: 1080 aa     Download sequence    Send to blast
MDSPGRESGW GHCWSLLGWR GAVAGTGGGE RTDVRTLSRV LHLPEKKQRN SVEFELLRRM  60
ATKSDEYLPL KDFRVEIDDK QPTFSVCFWL YLSSSTTFPA TLIQVHSGAA GNSPFLVIRE  120
NKKLRLYLMG LLPRKAADQC GSASLSEVPH IDVWSQFPME KWVHVGWEVS SDFVRLHIDG  180
EDVGNKDISS LFNKDSISTG LSKISLAFCG GDGNNMQGYV HHPNILPLTS SIMEYFAKDP  240
PLQLSFDNSS VSEIEELSNG VWSIVGGKAS CRRIFSLDVV LLDAFSHTIN KELEVIASLA  300
YYDNGAHVDK TSDGEPPLLA IHDGIEFASC DRPTKVVQGR ASFKLKISQL SSKCDNRLFR  360
IIFQIPNWEN YPFLKAFTPP IRCVSPSHNA VVSSIMLGRS PYAPLNVYQP LGLDDKALEL  420
QNISAPEDKL NPSPKRLKLG NQVENAFVKN LVGRANNVEE VDDSRSNSEN PEARNSTLKS  480
TSSSRIPMSD VTVFKYCLAG LTEKSLLLKE IATSASNEEL QDFAHQVSLY SGCSHHRHQI  540
IMAKKLVEEG TKAWKLISQN SDQVQWESVV LEIEEQFMKI ACCSSRSLTK QDFELLKRIA  600
GCKEYLAQEN FEKMWCWLYP VAFTLSKDGI NTMWSSTSPK WIEGFITKEE AESSLQPSRG  660
FQEPGTFVLR FPTSRSWPHP DAGSLVVTYL GSKCTIHHKL ISLDTIASSE EKNTKPLQDM  720
LLDNKKSLSS LGCLSTIPFL GNNVFHVLKR IIIAVLIYRR WKRKHLVFEH GFSGGKMVLF  780
RAPVMQSLKS DVFLKKTLKL SNKDIIGSGG YGTVYKLTVN ETMAFAVKRL NRGSADRDRG  840
FERELEAMGD IKHRNIVTLH GYYTAPHYNL LIYELVANGS LDGVLHGRSM TNKRLDWPAR  900
YKVALGAARG ISYLHHDCIP HIIHRDIKSS NILLDQNMEA RVSDFGLATL MEPDKTHVST  960
LVAGTFGYLA PEYFDTGRAT AKGDVYSFGV VLLELLTGKK PTDEAFVEEG TKLVTWVKAV  1020
VQDKKEEYVL DNKLGCCPED EINSAFSIAL MCLEPEPSKR PTMAEVVKML EQIRSDKVL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4oh4_B3e-75778107516321Protein BRASSINOSTEROID INSENSITIVE 1
4oh4_A3e-75778107516321Protein BRASSINOSTEROID INSENSITIVE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004295681.10.0PREDICTED: uncharacterized protein LOC101298500
TrEMBLM5WQ300.0M5WQ30_PRUPE; Uncharacterized protein
STRINGPOPTR_0011s10360.10.0(Populus trichocarpa)
STRINGVIT_19s0014g00140.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67103036
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78540.10.0SH2 domain protein B